CAS Number: 87805-34-3Molecular Weight: 4167.03Salt Form: TFAPurity: >95%Sequence (3-letter): His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OHSequence (1-letter): HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-OHStorage: -20 °C or belowSolubility: water to 5 mg/mL
Glucagon-like peptide-1 (GLP-1) is an incretin produced primarily in ileal L cells. GLP-1 secretion by these cells is dependent on the presence of nutrients in the lumen of the small intestine. GLP-1 promotes satiety and sustained GLP-1-receptor activation correlates with weight loss. The biologically active forms of GLP-1 are GLP-1 (7-37) and GLP-1 (7-36)NH2 (cat # 471-39 and 471-28, respectively) which are produced as a result of selective cleavage of proglucagon.
References
1. Baggio, L.L. and Drucker, D.J. (2007) “Biology of Incretins: GLP-1 and GIP” Gastroenterology 132 (6): 2131-57.2. Kastin, A.J., Akerstrom, V. and Pan, W. (2002) “Interactions of glucagon-like peptide-1 (GLP-1) with the blood-brain barrier” J. Mol. Neurosci. 18 (1-2): 7-14.
| Categories | Peptides |
|---|
| Filter | Metabolic / Diabetes, Neuropeptides & Hormones |
|---|